PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009608945.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 325aa    MW: 35816 Da    PI: 8.9111
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009608945.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.39.5e-32184238358
       CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     p+YVNaKQy++IlkRRq Rakle ++kl  k rkpylheSRh+hA++R+Rg+gGrF
  XP_009608945.1 184 PIYVNAKQYSAILKRRQVRAKLEVQNKL-VKDRKPYLHESRHRHAMKRARGTGGRF 238
                     9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-36180241IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.821181241IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-27184238IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.8E-24184206IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860186206IPR018362CCAAT-binding factor, conserved site
PRINTSPR006168.8E-24215238IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MISFSQKGVC GKEGQSFTPL FVNCSSMWSS GEQPENAPSK SVLTGAESAS KCHFNIKQSE  60
SQYQDQDSTS TLSTGQSDHV ETPMAKSNTV LQNVALHPGW DGIYEVQGER GTKASLSGKN  120
ATNTLSQPHV HHNHPMACLS YPWADTYFGR LVATYGSNAI IYPQMVGVTS TRVALPLECT  180
ESLPIYVNAK QYSAILKRRQ VRAKLEVQNK LVKDRKPYLH ESRHRHAMKR ARGTGGRFLN  240
TQNMQQSKPS SPTHDKSIFK GTAGGNLTRS MVQHSESGSW GTSTQSGSDV TSIFSGDDMF  300
QQPEFRVSGF PFHMQEAEDF MHVGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-20184252472NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222231RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ8654090.0KJ865409.1 Capsicum annuum cultivar CMS line FS4401 mitochondrion, complete genome.
GenBankKJ8654100.0KJ865410.1 Capsicum annuum cultivar Jeju mitochondrion, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608945.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_009608946.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_009608947.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
TrEMBLK4CL100.0K4CL10_SOLLC; Uncharacterized protein
STRINGSolyc08g062210.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48002027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.15e-45nuclear factor Y, subunit A3